Mitochondrial DNA diversification among the subspecies of the Silver and Kalij Pheasants, Lophura nycthemera and L. leucomelanos , Phasianidae
نویسندگان
چکیده
The taxonomic status of the pheasant superspecies Lophura leucomelanos and Lophura nycthemera has been unclear since 1948. Molecular techniques provided the opportunity to clarify the situation. Using sequences of mitochondrial DNA (800 nucleotides from the D-loop, plus 400 from the cyt b ) from 49 specimens belonging to 10 subspecies (plus two outgroups), we constructed a phylogeny of the subspecies of L. nycthemera and L. leucomelanos . Our data support the monophyly of both species. L. l. lineata and L. l. crawfurdi belong to L. leucomelanos and not to L. nycthemera (suggested by other authors). Our data also confirm a northern locality of origin (Central Buthan) for L. l. moffitti , and have clarified the relationships between subspecies within each species: there are three groups within L. leucomelanos and two within L. nycthemera .
منابع مشابه
The amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.
The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGM...
متن کاملAssessing Phylogenetic Relationships among Galliformes: A Multigene Phylogeny with Expanded Taxon Sampling in Phasianidae
Galliform birds (relatives of the chicken and turkey) have attracted substantial attention due to their importance to society and value as model systems. This makes understanding the evolutionary history of Galliformes, especially the species-rich family Phasianidae, particularly interesting and important for comparative studies in this group. Previous studies have differed in their conclusions...
متن کاملPhylogenetic relationships of the phasianidae reveals possible non-pheasant taxa.
The phylogenetic relationships of 21 pheasant and 6 non-pheasant species were determined using nucleotide sequences from the mitochondrial cytochrome b gene. Maximum parsimony and maximum likelihood analysis were used to try to resolve the phylogenetic relationships within Phasianidae. Both the degree of resolution and strength of support are improved over previous studies due to the testing of...
متن کاملGenetic diversity in the Persian sturgeon, Acipenser percicus, from the south Caspian Sea based on mitochondrial DNA sequences of the control region
The Persian sturgeon, Acipenser persicus (Borodin, 1897), is an economically important species, which mainly inhabits the Caspian Sea. However, little is known about its population genetic structure. In this study, variation in nucleotide sequences of the mitochondrial DNA (mtDNA) control region of wild stock Persian sturgeon was determined to assess the genetic diversity among different natura...
متن کاملEvaluation of effectiveness of some mitochondrial genes in biosystematics and phylogeographic studies of house mouse (Mus musculus ) subspecies
The identification of the efficiency of some mtDNA genes of Mus musculus species complex (house mouse) for biosystematics research was studied in this approach. Recent studies have made use of different mitochondrial genes including NADH dehydrogenase genes, cytochrome b gene, cytochrome oxidase genes, D-loop region and whole mtDNA genome to study the house mouse species. Usage of each of these...
متن کامل